POP5 Antibody - middle region : Biotin

POP5 Antibody - middle region : Biotin
Artikelnummer
AVIARP56773_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: POP5 is a component of ribonuclease P, a protein complex that generates mature tRNA molecules by cleaving their 5'-ends.POP5 is also a component of RNase MRP.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human POP5

Molecular Weight: 19kDa

Peptide Sequence: Synthetic peptide located within the following region: KEFYQLVWSALPFITYLENKGHRYPCFFNTLHVGGTIRTCQKFLIQYNRR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ribonuclease P/MRP protein subunit POP5

Protein Size: 163

Purification: Affinity Purified

Subunit: POP5
Mehr Informationen
Artikelnummer AVIARP56773_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56773_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 51367
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×