Pou3f3 Antibody - C-terminal region : HRP

Pou3f3 Antibody - C-terminal region : HRP
Artikelnummer
AVIARP57888_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Pou3f3 acts as a transcriptional activator in oligodendrocytes; Pou3f3 may play a role in regulation of neural development

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Pou3f3

Molecular Weight: 54kDa

Peptide Sequence: Synthetic peptide located within the following region: VVRVWFCNRRQKEKRMTPPGIQQQTPDDVYSQVGTVSADTPPPHHGLQTS

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: POU domain, class 3, transcription factor 3

Protein Size: 497

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57888_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57888_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine)
Klonalität Polyclonal
Methode Western Blotting, Immunohistochemistry
Human Gene ID 192109
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×