PPID Antibody - N-terminal region : FITC

PPID Antibody - N-terminal region : FITC
Artikelnummer
AVIARP56624_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: PPID is a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. This protein has been shown to possess PPIas

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PPID

Key Reference: Kajitani,K., (2008) Proteins 70 (4), 1635-1639

Molecular Weight: 41kDa

Peptide Sequence: Synthetic peptide located within the following region: CPFHRIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFHYKHDREGLLSM

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Peptidyl-prolyl cis-trans isomerase D

Protein Size: 370

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56624_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56624_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 5481
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×