PPID Antibody - N-terminal region : HRP

PPID Antibody - N-terminal region : HRP
Artikelnummer
AVIARP56624_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: PPID is a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. This protein has been shown to possess PPIas

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PPID

Key Reference: Kajitani,K., (2008) Proteins 70 (4), 1635-1639

Molecular Weight: 41kDa

Peptide Sequence: Synthetic peptide located within the following region: CPFHRIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFHYKHDREGLLSM

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Peptidyl-prolyl cis-trans isomerase D

Protein Size: 370

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56624_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56624_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 5481
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×