PPM1B Antibody - N-terminal region : HRP

PPM1B Antibody - N-terminal region : HRP
Artikelnummer
AVIARP57767_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The protein encoded by this gene is a member of the PP2C family of Ser/Thr protein phosphatases. PP2C family members are known to be negative regulators of cell stress response pathways. This phosphatase has been shown to dephosphorylate cyclin-dependent

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PPM1B

Key Reference: Xiao,K., (2007) Proc. Natl. Acad. Sci. U.S.A. 104 (29), 12011-12016

Molecular Weight: 21kDa

Peptide Sequence: Synthetic peptide located within the following region: EIMEKSGEEGMPDLAHVMRILSAENIPNLPPGGGLAGKRNVIEAVYSRLN

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Protein phosphatase 1B

Protein Size: 192

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57767_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57767_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 5495
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×