PPM1J Antibody - C-terminal region : Biotin

PPM1J Antibody - C-terminal region : Biotin
Artikelnummer
AVIARP54745_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: PPM1J is the serine/threonine protein phosphatase. The mouse homolog of this protein apparently belongs to the protein phosphatase 2C family. The exact function of this protein is not yet known.This gene encodes the serine/threonine protein phosphatase. The mouse homolog of this gene apparently belongs to the protein phosphatase 2C family of genes. The exact function of this gene is not yet known.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human PPM1J

Key Reference: Komaki,K., Biochim. Biophys. Acta 1630 (2-3), 130-137 (2003)

Molecular Weight: 55kDa

Peptide Sequence: Synthetic peptide located within the following region: YTALAQALVLGARGTPRDRGWRLPNNKLGSGDDISVFVIPLGGPGSYS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein phosphatase 1J

Protein Size: 505

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54745_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54745_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 333926
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×