PPME1 Antibody - N-terminal region : FITC

PPME1 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP56845_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Protein phosphatase methylesterase-1 catalyzes the demethylation of the protein phosphatase-2A catalytic subunit.Protein phosphatase methylesterase-1 catalyzes the demethylation of the protein phosphatase-2A catalytic subunit (PPP2CA; MIM 176915) (Ogris et al., 1999 [PubMed 10318862]).[supplied by OMIM].

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PPME1

Key Reference: Longin,S., (2008) Exp. Cell Res. 314 (1), 68-81

Molecular Weight: 42kDa

Peptide Sequence: Synthetic peptide located within the following region: PGRKRDFSPVPWSQYFESMEDVEVENETGKDTFRVYKSGSEGPVLLLLHG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein phosphatase methylesterase 1

Protein Size: 386

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56845_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56845_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting, Immunohistochemistry
Human Gene ID 51400
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×