Ppp1r7 Antibody - C-terminal region : FITC

Ppp1r7 Antibody - C-terminal region : FITC
Artikelnummer
AVIARP56408_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Ppp1r7 is a regulatory subunit of protein phosphatase 1.

Molecular Weight: 39kDa

Peptide Sequence: Synthetic peptide located within the following region: SHLTELQEFWMNDNLLESWSDLDELKGARSLETVYLERNPLQKDPQYRRK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein phosphatase 1 regulatory subunit 7

Protein Size: 360

Purification: Affinity Purified

Subunit: 7
Mehr Informationen
Artikelnummer AVIARP56408_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56408_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 301618
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×