Ppp1r7 Antibody - C-terminal region : HRP

Ppp1r7 Antibody - C-terminal region : HRP
Artikelnummer
AVIARP56408_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Ppp1r7 is a regulatory subunit of protein phosphatase 1.

Molecular Weight: 39kDa

Peptide Sequence: Synthetic peptide located within the following region: SHLTELQEFWMNDNLLESWSDLDELKGARSLETVYLERNPLQKDPQYRRK

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Protein phosphatase 1 regulatory subunit 7

Protein Size: 360

Purification: Affinity Purified

Subunit: 7
Mehr Informationen
Artikelnummer AVIARP56408_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56408_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 301618
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×