PPP2CA Antibody - N-terminal region : Biotin

PPP2CA Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP56186_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: This gene encodes the phosphatase 2A catalytic subunit. Protein phosphatase 2A is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. This gene encodes an alpha isoform of the catalytic subunit.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human PPP2CA

Molecular Weight: 28kDa

Peptide Sequence: Synthetic peptide located within the following region: FHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform

Protein Size: 255

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56186_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56186_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 5515
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×