PPP2R1A Antibody - middle region : Biotin

PPP2R1A Antibody - middle region : Biotin
Artikelnummer
AVIARP56742_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: PPP2R1A is a constant regulatory subunit of protein phosphatase 2. Protein phosphatase 2 is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzy

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PPP2R1A

Molecular Weight: 65kDa

Peptide Sequence: Synthetic peptide located within the following region: NVAKSLQKIGPILDNSTLQSEVKPILEKLTQDQDVDVKYFAQEALTVLSL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform

Protein Size: 589

Purification: Affinity Purified

Subunit: A alpha isoform
Mehr Informationen
Artikelnummer AVIARP56742_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56742_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 5518
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×