Ppp2r2a Antibody - C-terminal region : Biotin

Ppp2r2a Antibody - C-terminal region : Biotin
Artikelnummer
AVIARP56158_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: Human homolog forms a complex with cyclin G2 that may inhibit cell cycle progression.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Ppp2r2a

Molecular Weight: 49kDa

Peptide Sequence: Synthetic peptide located within the following region: ASRENNKPRTVLKPRKVCASGKRKKDEISVDSLDFNKKILHTAWHPKENI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B alpha isoform

Protein Size: 447

Purification: Affinity Purified

Subunit: B alpha isoform
Mehr Informationen
Artikelnummer AVIARP56158_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56158_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 117104
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×