Ppp2r2c Antibody - N-terminal region : FITC

Ppp2r2c Antibody - N-terminal region : FITC
Artikelnummer
AVIARP57784_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The B regulatory subunit might modulate substrate selectivity and catalytic activity, and also might direct the localization of the catalytic enzyme to a particular subcellular compartment.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse

Molecular Weight: 49kDa

Peptide Sequence: Synthetic peptide located within the following region: VTEADVISTVEFNHTGELLATGDKGGRVVIFQREPESKNAPHSQGEYDVY

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B gamma isoform

Protein Size: 447

Purification: Affinity Purified

Subunit: B gamma isoform
Mehr Informationen
Artikelnummer AVIARP57784_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57784_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 269643
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×