PPP2R3A Antibody - N-terminal region : HRP

PPP2R3A Antibody - N-terminal region : HRP
Artikelnummer
AVIARP56410_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Protein phosphatase 2 (formerly named type 2A) is one of the four major Ser/Thr phosphatases and is implicated in the negative control of cell growth and division. Protein phosphatase 2 holoenzymes are heterotrimeric proteins composed of a structural subu

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PPP2R3A

Key Reference: Ahn,J.H., (2007) Proc. Natl. Acad. Sci. U.S.A. 104 (23), 9876-9881

Molecular Weight: 130kDa

Peptide Sequence: Synthetic peptide located within the following region: SSSVEEKPLSHRNSLDTNLTSMFLQNFSEEDLVTQILEKHKIDNFSSGTD

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit alpha

Protein Size: 1150

Purification: Affinity Purified

Subunit: B
Mehr Informationen
Artikelnummer AVIARP56410_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56410_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting, Immunohistochemistry
Human Gene ID 5523
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×