PPP2R5C Antibody - middle region : Biotin

PPP2R5C Antibody - middle region : Biotin
Artikelnummer
AVIARP57771_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The product of this gene belongs to the phosphatase 2A regulatory subunit B family. Protein phosphatase 2A is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common het

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PPP2R5C

Key Reference: Shouse,G.P., (2008) Mol. Cell. Biol. 28 (1), 448-456

Molecular Weight: 45kDa

Peptide Sequence: Synthetic peptide located within the following region: RFLESPDFQPNIAKKYIDQKFVLQLLELFDSEDPRERDFLKTTLHRIYGK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein phosphatase 2, regulatory subunit B', gamma isoform EMBL AAH16183.1

Protein Size: 384

Purification: Affinity Purified

Subunit: gamma isoform
Mehr Informationen
Artikelnummer AVIARP57771_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57771_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 5527
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×