Ppp2r5e Antibody - N-terminal region : Biotin

Ppp2r5e Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP56694_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The B regulatory subunit might modulate substrate selectivity and catalytic activity, and also might direct the localization of the catalytic enzyme to a particular subcellular compartment. Ppp2r5e interacts with cyclin G in vitro.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse

Molecular Weight: 51kDa

Peptide Sequence: Synthetic peptide located within the following region: SCNIFRTLPPSDSNEFDPEEDEPTLEASWPHLQLVYEFFIRFLESQEFQP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit epsilon isoform

Protein Size: 467

Purification: Affinity Purified

Subunit: epsilon isoform
Mehr Informationen
Artikelnummer AVIARP56694_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56694_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 26932
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×