PPP3R1 Antibody - N-terminal region : FITC

PPP3R1 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP56124_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: PPP3R1 is the regulatory subunit of calcineurin, a calcium-dependent, calmodulin stimulated protein phosphatase. PPP3R1 confers calcium sensitivity.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PPP3R1

Key Reference: Wang,Y.L., (2008) Cancer Sci. 99 (6), 1100-1108

Molecular Weight: 19kDa

Peptide Sequence: Synthetic peptide located within the following region: MGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Calcineurin subunit B type 1

Protein Size: 170

Purification: Affinity Purified

Subunit: B type 1
Mehr Informationen
Artikelnummer AVIARP56124_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56124_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 5534
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×