PPP3R1 Antibody - N-terminal region : HRP

PPP3R1 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP56124_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: PPP3R1 is the regulatory subunit of calcineurin, a calcium-dependent, calmodulin stimulated protein phosphatase. PPP3R1 confers calcium sensitivity.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PPP3R1

Key Reference: Wang,Y.L., (2008) Cancer Sci. 99 (6), 1100-1108

Molecular Weight: 19kDa

Peptide Sequence: Synthetic peptide located within the following region: MGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQ

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Calcineurin subunit B type 1

Protein Size: 170

Purification: Affinity Purified

Subunit: B type 1
Mehr Informationen
Artikelnummer AVIARP56124_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56124_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 5534
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×