PPP4R3B Antibody - C-terminal region : HRP

PPP4R3B Antibody - C-terminal region : HRP
Artikelnummer
AVIARP57424_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse

Molecular Weight: 90kDa

Peptide Sequence: Synthetic peptide located within the following region: DSYEKFMETKKAKESEDKENLPKRASSGGFKFTFSHSPSATNGTNSTNSK

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: serine/threonine-protein phosphatase 4 regulatory subunit 3B

Protein Size: 820

Purification: Affinity Purified

Subunit: 3B
Mehr Informationen
Artikelnummer AVIARP57424_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57424_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 104570
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×