PPP4R3B Antibody - middle region : HRP

PPP4R3B Antibody - middle region : HRP
Artikelnummer
AVIARP57423_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human P4R3B

Molecular Weight: 30kDa

Peptide Sequence: Synthetic peptide located within the following region: EYVQTFKGLKTKYEQEKDRQNQKLNSNRFRRDAKALEEDEEMWFNEDEEE

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: serine/threonine-protein phosphatase 4 regulatory subunit 3B

Protein Size: 276

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57423_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57423_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 57223
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×