Ppp4r4 Antibody - C-terminal region : FITC

Ppp4r4 Antibody - C-terminal region : FITC
Artikelnummer
AVIARP57709_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Ppp4r4 is a putative regulatory subunit of serine/threonine-protein phosphatase 4.

Molecular Weight: 96kDa

Peptide Sequence: Synthetic peptide located within the following region: VKKTVLELDRMEMSMDMFQKKNYEKDLLDQEKEREELLFLEMEQLEKEKH

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Serine/threonine-protein phosphatase 4 regulatory subunit 4

Protein Size: 875

Purification: Affinity Purified

Subunit: 4
Mehr Informationen
Artikelnummer AVIARP57709_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57709_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 74521
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×