PPP5C Antibody - N-terminal region : Biotin

PPP5C Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP56695_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: PPP5C may play a role in the regulation of RNA biogenesis and/or mitosis. In vitro, PPP5C dephosphorylates serine residues of skeletal muscle phosphorylase and histone H1.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PPP5C

Key Reference: Golden,T., (2008) Biochim. Biophys. Acta 1782 (4), 259-270

Molecular Weight: 57kDa

Peptide Sequence: Synthetic peptide located within the following region: MAMAEGERTECAEPPRDEPPADGALKRAEELKTQANDYFKAKDYENAIKF

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Serine/threonine-protein phosphatase 5

Protein Size: 499

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56695_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56695_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Guinea Pig, Cow (Bovine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 5536
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×