PPWD1 Antibody - middle region : FITC

PPWD1 Antibody - middle region : FITC
Artikelnummer
AVIARP55238_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: PPWD1 is a putative peptidylprolyl isomerase (PPIase). PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. PPWD1 may be involved in pre-mRNA splicing.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PPWD1

Key Reference: Jurica,M.S., (2002) RNA 8 (4), 426-439

Molecular Weight: 73kDa

Peptide Sequence: Synthetic peptide located within the following region: FMIQTGDPTGTGMGGESIWGGEFEDEFHSTLRHDRPYTLSMANAGSNTNG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Peptidylprolyl isomerase domain and WD repeat-containing protein 1

Protein Size: 646

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55238_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55238_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Goat (Caprine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 23398
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×