PRAMEF10 Antibody - middle region : Biotin

PRAMEF10 Antibody - middle region : Biotin
Artikelnummer
AVIARP54493_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: PRAMEF10 belongs to the PRAME family. It contains 3 LRR (leucine-rich) repeats. The function of the PRAMEF10 protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PRAMEF10

Key Reference: Gregory,S.G., (2006) Nature 441 (7091), 315-321

Molecular Weight: 55kDa

Peptide Sequence: Synthetic peptide located within the following region: DLLRHTGGLSKLGLELYPAPLESLDYKGHVNWEILTPIRAELMRTLREVR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: PRAME family member 10

Protein Size: 474

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54493_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54493_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Rabbit
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 343071
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×