Preb Antibody - N-terminal region : FITC

Preb Antibody - N-terminal region : FITC
Artikelnummer
AVIARP57930_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Preb was first identified based on its probable role in the regulation of pituitary gene transcription. It binds to the prolactin gene (PRL) promoter and seems to activate transcription. Guanine nucleotide exchange factor that activates SARA2. It is also required for the formation of COPII transport vesicles from the ER.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Preb

Molecular Weight: 45kDa

Peptide Sequence: Synthetic peptide located within the following region: RRRGVELYRAPFPLYALRIDPKTGLLIAAGGGGAAKTGIKNGVHFLQLEL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Prolactin regulatory element-binding protein

Protein Size: 417

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57930_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57930_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 50907
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×