PRELID2 Antibody - C-terminal region : FITC

PRELID2 Antibody - C-terminal region : FITC
Artikelnummer
AVIARP53440_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: PRELID2 contains 1 PRELI/MSF1 domain. The exact function of PRELID2 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human PRELID2

Key Reference: Ota,T., (2004) Nat. Genet. 36 (1), 40-45

Molecular Weight: 22kDa

Peptide Sequence: Synthetic peptide located within the following region: GRISITGVGFLNCVLETFASTFLRQGAQKGIRIMEMLLKEQCGAPLAE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: PRELI domain-containing protein 2

Protein Size: 189

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP53440_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP53440_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 153768
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×