PRELID3B Antibody - N-terminal region : Biotin

PRELID3B Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP56814_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SLMO2

Molecular Weight: 21kDa

Peptide Sequence: Synthetic peptide located within the following region: GVDVLDRHIDPSGKLHSHRLLSTEWGLPSIVKSLIGAARTKTYVQEHSVV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: PRELI domain containing protein 3B

Protein Size: 194

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56814_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56814_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 51012
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×