PRELID3B Antibody - N-terminal region : HRP

PRELID3B Antibody - N-terminal region : HRP
Artikelnummer
AVIARP56814_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SLMO2

Molecular Weight: 21kDa

Peptide Sequence: Synthetic peptide located within the following region: GVDVLDRHIDPSGKLHSHRLLSTEWGLPSIVKSLIGAARTKTYVQEHSVV

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: PRELI domain containing protein 3B

Protein Size: 194

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56814_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56814_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 51012
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×