PREP Antibody - N-terminal region : HRP

PREP Antibody - N-terminal region : HRP
Artikelnummer
AVIARP56413_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: PREP is a cytosolic prolyl endopeptidase that cleaves peptide bonds on the C-terminal side of prolyl residues within peptides that are up to approximately 30 amino acids long. Prolyl endopeptidases have been reported to be involved in the maturation and d

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PREP

Key Reference: Myohanen,T.T., (2007) Neurochem. Res. 32 (8), 1365-1374

Molecular Weight: 81kDa

Peptide Sequence: Synthetic peptide located within the following region: THDGKGMFYNSYPQQDGKSDGTETSTNLHQKLYYHVLGTDQSEDILCAEF

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Prolyl endopeptidase

Protein Size: 710

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56413_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56413_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 5550
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×