PrEST Antigen C19orf18

chromosome 19 open reading frame 18

Sequence: DEGESTHLLPENENELEKFIHSVIISKRSKNIKKKLKEEQNSVTENKTKNASHNGKMEDL

GeneName: C19orf18

Ensembl Gene ID: ENSG00000177025

UniProt ID: Q8NEA5

Entrez Gene ID: 147685

Buffer: PBS and 1M Urea, pH 7.4.

Interspecies Mouse/Rat: ENSRNOG00000022325: 33%, ENSMUSG00000028312: 33%

Atlas Antibodies attaches great importance to sustainability. In the production process of their high quality antibodies, Atlas follows the highest and most rigorous ethical animal welfare standards. The products are produced within Europe, which reduces the supply chain length to a minimum and WoolCool (100% natural sheep wool) is used as an insulating material instead of Styrofoam for the transportation of refrigerated goods.

• Artikelnummer: ATLAPREST95527-100
• Hersteller: Atlas Antibodies
• Hersteller Artikelnummer: APrEST95527-100
• Verpackungseinheit: 100 µl
• Mengeneinheit: STK
• Human Gene ID: 147685
• Konjugat: Unconjugated