PrEST Antigen C22orf31

chromosome 22 open reading frame 31
Artikelnummer
ATLAPREST94987-100
Verpackungseinheit
100 µl
Hersteller
Atlas Antibodies

Verfügbarkeit: wird geladen...
Preis wird geladen...
Sequence: HPINVRRDPSIPIYGLRQSILLNTRLQDCYVDSPALTNIWMARTCAKQNINAPAPATTSSWEVVRNPLIASSFSLVKLVLRRQLKNKCCPPPCKFGEGKLSKRLKHKDDSVMKATQQARKRNFISSKSKQPAGHRR

GeneName: C22orf31

Ensembl Gene ID: ENSG00000100249

UniProt ID: O95567

Entrez Gene ID: 25770

Buffer: PBS and 1M Urea, pH 7.4.

Interspecies Mouse/Rat: ENSMUSG00000026360: 18%, ENSRNOG00000010846: 20%

Atlas Antibodies attaches great importance to sustainability. In the production process of their high quality antibodies, Atlas follows the highest and most rigorous ethical animal welfare standards. The products are produced within Europe, which reduces the supply chain length to a minimum and WoolCool (100% natural sheep wool) is used as an insulating material instead of Styrofoam for the transportation of refrigerated goods.

Mehr Informationen
Artikelnummer ATLAPREST94987-100
Hersteller Atlas Antibodies
Hersteller Artikelnummer APrEST94987-100
Verpackungseinheit 100 µl
Mengeneinheit STK
Human Gene ID 25770
Konjugat Unconjugated
Produktinformation (PDF) Download
MSDS (PDF) Download