PrEST Antigen SLC20A1

solute carrier family 20 member 1
Artikelnummer
ATLAPrEST96161-100
Verpackungseinheit
100 µl
Hersteller
Atlas Antibodies

Verfügbarkeit: wird geladen...
Preis wird geladen...
GeneName: SLC20A1

Sequence: YTSYCNAVSDLHSASEIDMSVKAEMGLGDRKGSNGSLEEWYDQDKPEVS

Interspecies Mouse/Rat: ENSMUSG00000027397: 94%, ENSRNOG00000018567: 94%

Entrez Gene ID: 6574

UniProt ID: Q8WUM9

Buffer: PBS and 1M Urea, pH 7.4.

Ensembl Gene ID: ENSG00000144136

Atlas Antibodies attaches great importance to sustainability. In the production process of their high quality antibodies, Atlas follows the highest and most rigorous ethical animal welfare standards. The products are produced within Europe, which reduces the supply chain length to a minimum and WoolCool (100% natural sheep wool) is used as an insulating material instead of Styrofoam for the transportation of refrigerated goods.

Mehr Informationen
Artikelnummer ATLAPrEST96161-100
Hersteller Atlas Antibodies
Hersteller Artikelnummer APrEST96161-100
Verpackungseinheit 100 µl
Mengeneinheit STK
Human Gene ID 6574
Produktinformation (PDF) Download
MSDS (PDF) Download