Prkaa1 Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: Prkaa1 is a catalytic subunit of AMP-activated protein kinase (AMPK), an energy sensor protein kinase that plays a key role in regulating cellular energy metabolism.

Molecular Weight: 60kDa

Peptide Sequence: Synthetic peptide located within the following region: STPSDIFMVMEYVSGGELFDYICKNGRLDEKESRRLFQQILSGVDYCHRH

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: 5'-AMP-activated protein kinase catalytic subunit alpha-1

Protein Size: 548

Purification: Affinity Purified

Subunit: alpha-1

• Artikelnummer: AVIARP53651_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP53651_P050-HRP
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 105787
• Wirt: Rabbit
• Konjugat: Conjugated, HRP