PRKAA1 Antibody - N-terminal region : HRP

PRKAA1 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP53846_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: PRKAA1 belongs to the ser/thr protein kinase family. It is the catalytic subunit of the 5'-prime-AMP-activated protein kinase (AMPK). AMPK is a cellular energy sensor conserved in all eukaryotic cells. The kinase activity of AMPK is activated by the stimuli that increase the cellular AMP/ATP ratio. AMPK regulates the activities of a number of key metabolic enzymes through phosphorylation. It protects cells from stresses that cause ATP depletion by switching off ATP-consuming biosynthetic pathways.The protein encoded by this gene belongs to the ser/thr protein kinase family. It is the catalytic subunit of the 5'-prime-AMP-activated protein kinase (AMPK). AMPK is a cellular energy sensor conserved in all eukaryotic cells. The kinase activity of AMPK is activated by the stimuli that increase the cellular AMP/ATP ratio. AMPK regulates the activities of a number of key metabolic enzymes through phosphorylation. It protects cells from stresses that cause ATP depletion by switching off ATP-consuming biosynthetic pathways. Alternatively spliced transcript variants encoding distinct isoforms have been observed.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PRKAA1

Key Reference: Hasumi,H., Gene 415 (1-2), 60-67 (2008)

Molecular Weight: 62kDa

Peptide Sequence: Synthetic peptide located within the following region: GELFDYICKNGRKSDVPGVVKTGSTKELDEKESRRLFQQILSGVDYCHRH

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: 5'-AMP-activated protein kinase catalytic subunit alpha-1

Protein Size: 565

Purification: Affinity Purified

Subunit: alpha-1
Mehr Informationen
Artikelnummer AVIARP53846_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP53846_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Rat (Rattus), Rabbit
Klonalität Polyclonal
Methode Western Blotting, Immunohistochemistry
Human Gene ID 5562
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×