PRKAA2 Antibody - middle region : Biotin

PRKAA2 Antibody - middle region : Biotin
Artikelnummer
AVIARP56697_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The protein encoded by this gene is a catalytic subunit of the AMP-activated protein kinase (AMPK). AMPK is a heterotrimer consisting of an alpha catalytic subunit, and non-catalytic beta and gamma subunits. AMPK is an important energy-sensing enzyme that

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PRKAA2

Key Reference: Qin,S. (2008) J. Biol. Chem. 283 (11), 6744-6751

Molecular Weight: 62kDa

Peptide Sequence: Synthetic peptide located within the following region: AYHLIIDNRRIMNQASEFYLASSPPSGSFMDDSAMHIPPGLKPHPERMPP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: 5'-AMP-activated protein kinase catalytic subunit alpha-2

Protein Size: 552

Purification: Affinity Purified

Subunit: alpha-2
Mehr Informationen
Artikelnummer AVIARP56697_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56697_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 5563
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×