Prkar1a Antibody - N-terminal region : HRP

Prkar1a Antibody - N-terminal region : HRP
Artikelnummer
AVIARP57831_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Prkar1a is a regulatory subunit of cAMP-dependent protein kinase (PKA); negatively regulates meiosis .

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Prkar1a

Molecular Weight: 41kDa

Peptide Sequence: Synthetic peptide located within the following region: REYFERLEKEEARQIQSLQKSGIRTDSREDEISPPPPNPVVKGRRRRGAI

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: cAMP-dependent protein kinase type I-alpha regulatory subunit

Protein Size: 381

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57831_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57831_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 25725
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×