Prkch Antibody - C-terminal region : Biotin

Prkch Antibody - C-terminal region : Biotin
Artikelnummer
AVIARP56704_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: This is calcium-independent, phospholipid-dependent, serine- and threonine-specific enzyme.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse

Molecular Weight: 75kDa

Peptide Sequence: Synthetic peptide located within the following region: TPDYIAPEILQEMLYGPAVDWWAMGVLLYEMLCGHAPFEAENEDDLFEAI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein kinase C eta type

Protein Size: 683

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56704_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56704_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 18755
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×