PRKCQ Antibody - C-terminal region : FITC

PRKCQ Antibody - C-terminal region : FITC
Artikelnummer
AVIARP56706_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of mouse PRKCQ

Molecular Weight: 51kDa

Peptide Sequence: Synthetic peptide located within the following region: KVKSPYDCSNFDKEFLSEKPRLSFADRALINSMDQNMFSNFSFINPGMET

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: protein kinase C theta type

Protein Size: 464

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56706_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56706_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 18761
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×