PRKCQ Antibody - C-terminal region : HRP

PRKCQ Antibody - C-terminal region : HRP
Artikelnummer
AVIARP56706_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of mouse PRKCQ

Molecular Weight: 51kDa

Peptide Sequence: Synthetic peptide located within the following region: KVKSPYDCSNFDKEFLSEKPRLSFADRALINSMDQNMFSNFSFINPGMET

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: protein kinase C theta type

Protein Size: 464

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56706_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56706_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 18761
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×