PRKX Antibody - N-terminal region : FITC

PRKX Antibody - N-terminal region : FITC
Artikelnummer
AVIARP56626_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes a serine threonine protein kinase that has similarity to the catalytic subunit of cyclic AMP dependent protein kinases. The encoded protein is developmentally regulated and may be involved in renal epithelial morphogenesis. This protein

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PRKX

Key Reference: Li,X., (2008) Biochim. Biophys. Acta 1782 (1), 1-9

Molecular Weight: 41kDa

Peptide Sequence: Synthetic peptide located within the following region: MEAPGLAQAAAAESDSRKVAEETPDGAPALCPSPEALSPEPPVYSLQDFD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: cAMP-dependent protein kinase catalytic subunit PRKX

Protein Size: 358

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56626_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56626_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Rat (Rattus)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 5613
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×