Pros1 Antibody - C-terminal region : FITC

Pros1 Antibody - C-terminal region : FITC
Artikelnummer
AVIARP56098_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Pros1 is a component of the Protein C/Protein S anticoagulant system; human homolog interacts with factor Xa, factor Va, and phospholipids to inhibit prothrombin activation.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Rat

Molecular Weight: 74kDa

Peptide Sequence: Synthetic peptide located within the following region: LGGVPDISFSATPVNAFYSGCMEVNINGVQLDLDEAISKHNDIRAHSCPS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Vitamin K-dependent protein S

Protein Size: 675

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56098_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56098_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 81750
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×