PROS1 Antibody - middle region : Biotin

PROS1 Antibody - middle region : Biotin
Artikelnummer
AVIARP56097_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: PROS1 is an anticoagulant plasma protein; it is a cofactor to activated protein C in the degradation of coagulation factors Va and VIIIa. It helps to prevent coagulation and stimulating fibrinolysis.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PROS1

Key Reference: Ten (2008) Hum. Mutat. 29 (7), 939-947

Molecular Weight: 71kDa

Peptide Sequence: Synthetic peptide located within the following region: MCAQLCVNYPGGYTCYCDGKKGFKLAQDQKSCEVVSVCLPLNLDTKYELL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Vitamin K-dependent protein S

Protein Size: 676

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56097_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56097_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting, Immunohistochemistry
Human Gene ID 5627
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×