PROSER2 Antibody - C-terminal region : HRP

PROSER2 Antibody - C-terminal region : HRP
Artikelnummer
AVIARP55576_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of human PROSER2

Molecular Weight: 26kDa

Peptide Sequence: Synthetic peptide located within the following region: LCFRPGPALPSTRARQSFPGPRQPNGAQDWRRADSLPRPQGITVQFAGRG

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: proline and serine-rich protein 2

Protein Size: 239

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55576_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55576_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 254427
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×