PRPH Antibody - N-terminal region : HRP

PRPH Antibody - N-terminal region : HRP
Artikelnummer
AVIARP56707_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: This gene encodes a cytoskeletal protein found in neurons of the peripheral nervous system. The encoded protein is a type III intermediate filament protein with homology to other cytoskeletal proteins such as desmin, and is a different protein that the pe

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PRPH

Key Reference: Xiao,S., (2008) J. Neurosci. 28 (8), 1833-1840

Molecular Weight: 54kDa

Peptide Sequence: Synthetic peptide located within the following region: RFANFIEKVRFLEQQNAALRGELSQARGQEPARADQLCQQELRELRRELE

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Peripherin

Protein Size: 470

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56707_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56707_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 5630
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×