PRPSAP2 Antibody - middle region : HRP

PRPSAP2 Antibody - middle region : HRP
Artikelnummer
AVIARP56446_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The enzyme phosphoribosylpyrophosphate synthetase (PRS) catalyzes the formation of phosphoribosylpyrophosphate which is a substrate for synthesis of purine and pyrimidine nucleotides, histidine, tryptophan and NAD. PRS exists as a complex with two catalytic subunits and two associated subunits. This gene encodes a non-catalytic associated subunit of PRS.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PRPSAP2

Molecular Weight: 41kDa

Peptide Sequence: Synthetic peptide located within the following region: DYRNAVIVAKSPASAKRAQSFAERLRLGIAVIHGEAQDAESDLVDGRHSP

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Phosphoribosyl pyrophosphate synthase-associated protein 2

Protein Size: 369

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56446_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56446_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 5636
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×