PRR13 Antibody - middle region : FITC

PRR13 Antibody - middle region : FITC
Artikelnummer
AVIARP57260_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: PRR13 negatively regulates TSP1 expression at the level of transcription. This down-regulation was shown to reduce taxane-induced apoptosis.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PRR13

Molecular Weight: 15kDa

Peptide Sequence: Synthetic peptide located within the following region: PFPPGPCPPPPGAPHGNPAFPPGGPPHPVPQPGYPGCQPLGPYPPPYPPP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Proline-rich protein 13

Protein Size: 148

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57260_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57260_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 54458
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×