PRR16 Antibody - middle region : FITC

PRR16 Antibody - middle region : FITC
Artikelnummer
AVIARP56956_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PRR16

Key Reference: Barberi,T., PLoS Med. 2 (6), E161 (2005)

Molecular Weight: 30kDa

Peptide Sequence: Synthetic peptide located within the following region: RERVRFNEKVQYHGYCPDCDTRYNIKNREVHLHSEPVHPPGKIPHQGPPL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Proline-rich protein 16

Protein Size: 281

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56956_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56956_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 51334
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×