PRR18 Antibody - N-terminal region : Biotin

PRR18 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP55748_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The exact functions of PRR18 remain unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PRR18

Key Reference: Strausberg,R.L., (2002) Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903

Molecular Weight: 31kDa

Peptide Sequence: Synthetic peptide located within the following region: RPPQRPEGLLSSSWPSATLKRPPARRGPGLDRTQPPAPPGVSPQALPSRA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Proline-rich protein 18

Protein Size: 295

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55748_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55748_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 285800
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×