PRSS21 Antibody - N-terminal region : FITC

PRSS21 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP53665_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes a cell-surface anchored serine protease, which is a member of the trypsin family of serine proteases. It is predicted to be active on peptide linkages involving the carboxyl group of lysine or arginine. The protein localizes to the cytoplasm and the plasma membrane of premeiotic testicular germ cells and it may be involved in progression of testicular tumors of germ cell origin. Alternative splicing of this gene results in three transcript variants encoding three different isoforms.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PRSS21

Molecular Weight: 33kDa

Peptide Sequence: Synthetic peptide located within the following region: RRVITSRIVGGEDAELGRWPWQGSLRLWDSHVCGVSLLSHRWALTAAHCF

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Testisin

Protein Size: 300

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP53665_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP53665_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Guinea Pig
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 10942
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×