PRSS22 Antibody - N-terminal region : HRP

PRSS22 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP57603_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: This gene encodes a member of the trypsin family of serine proteases. The enzyme is expressed in the airways in a developmentally regulated manner. The gene is part of a cluster of serine protease genes on chromosome 16.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PRSS22

Molecular Weight: 34kDa

Peptide Sequence: Synthetic peptide located within the following region: IPVPPACGKPQQLNRVVGGEDSTDSEWPWIVSIQKNGTHHCAGSLLTSRW

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Brain-specific serine protease 4

Protein Size: 317

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57603_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57603_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 64063
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×